#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2amd assembly_id=1

Protein Model on 2amd assembly_id=1 (TEMPLATE: 2amd assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [309 aa] 3C-like proteinase :R1AB_CVHSA 1S 2G 3F 4R 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 298R 299Q 300C 302G (identity: 94.3 %/96.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_CVHSA
3 c C 1 (A) non-polymer(9IN) N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOXY-4-OXO-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-D-LEUCINAMIDE
4 d D 1 (B) non-polymer(9IN) N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOXY-4-OXO-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-D-LEUCINAMIDE 25T 26T 27L 41H 49M 140F 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2amd_B_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2amd_B_1       6:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 105
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :aaaa aaaaaa  a          ddd             d       d                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2amd_B_1     106:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 205
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebbeb:    
Contact         :                 a  aaaaaaaa        aaaaadddd                 ddda d a a              dddddd        
Contact         :                                       d                         d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2amd_B_1     206:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 305
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbebeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbeebbeeebeeeebeebeebbbbbbbebbeebb:    
Contact         :                                                                                    aa   a       aaa

queryA       301:SG: 302
                :**:
2amd_B_1     306:SG: 307
SecStr          :H :    
ExpBur          :ee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123