#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2d2d assembly_id=1

Protein Model on 2d2d assembly_id=1 (TEMPLATE: 2d2d assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_CVHSA 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 285A(T) 286L(I) 290E 299Q 300C 302G 303V (identity: 93.3 %/96.0 %)
3 c C 1 (A) non-polymer(ENB) ETHYL (2E,4S)-4-[((2R)-2-{[N-(TERT-BUTOXYCARBONYL)-L-VALYL]AMINO}-2-PHENYLETHANOYL)AMINO]-5-[(3S)-2-OXOPYRROLIDIN-3-YL]PENT-2-ENOATE 26T 27L 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 189Q 190T 191A 192Q (identity: 100.0 %/96.0 %)
4 d D 1 (B) non-polymer(ENB) ETHYL (2E,4S)-4-[((2R)-2-{[N-(TERT-BUTOXYCARBONYL)-L-VALYL]AMINO}-2-PHENYLETHANOYL)AMINO]-5-[(3S)-2-OXOPYRROLIDIN-3-YL]PENT-2-ENOATE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2d2d_A_1 identity=96.0%
queryA         3:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 102
                :******************************** ********** ****************** ******************** * ***** ********:
2d2d_A_1       8:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 107
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTS SS  HHHHHHT  GGGEEEEETTEEE B   EEETTEEEEEBSS  TT  SEE:    
ExpBur          :eeeeebebeebebbbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebeee:    
Contact         : bbbbbbbb  b           cc             c       c                                                     

queryA       103:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 202
                :******************************* ********************************************* ********************* :
2d2d_A_1     108:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 207
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEE  TTS BEEE TTS BSSS  SSSS        B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeebbebbb:    
Contact         :                   bbbbbbb        bbbbbcccc                 cccb c b c              c cccc          
Contact         :                                     cc                        c                                    

queryA       203:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG: 302
                :**************************************************************** *****************  ****************:
2d2d_A_1     208:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG: 307
SecStr          :HHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHSTTTT  BTTBSS      HHHHHHHHTT:    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebebbbbbebbebbeee:    
Contact         :                                                                                  bb   b        bb b

queryA       303:V: 303
                :*:
2d2d_A_1     308:V: 308
SecStr          : :    
ExpBur          :e:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123