#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2gtb assembly_id=1

Protein Model on 2gtb assembly_id=1 (TEMPLATE: 2gtb assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHSA 245D 249I (identity: 100.0 %/96.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHSA
3 c B 1 (A) non-polymer(AZP) (5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZYL-14-HYDROXY-5-ISOBUTYL-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,11-TETRAAZAPENTADECAN-15-OATE
4 d B 2 (A) non-polymer(AZP) (5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZYL-14-HYDROXY-5-ISOBUTYL-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,11-TETRAAZAPENTADECAN-15-OATE 25T 41H 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 187D 188R 189Q 190T 192Q 193A (identity: 100.0 %/96.0 %)
5 e C 1 (A) non-polymer(ACY) ACETIC ACID
6 f C 2 (A) non-polymer(ACY) ACETIC ACID 5K 7A 125V 126Y 127Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2gtb_A_2 identity=96.0%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :********************************* ********** ****************** ******************** * ***** *******:
2gtb_A_2       3:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 102
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeeebeebeeeebebeeeeeebebebeeebebbbebebeeebeeebee:    
Contact         :   f f                 d               d       d    d                                               

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                :******************************** ********************************************* *********************:
2gtb_A_2     103:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 202
SecStr          :EE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B H:    
ExpBur          :eeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeebb:    
Contact         :                       fff            dddddd                 dddddd   d              dddd dd        

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                : **************************************************************** *****************  **************:
2gtb_A_2     203:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 301
SecStr          :HHHHHHHHHHHHHT  TT  SS   HHHHHHHHHTTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHT  SS  BTTBSS   S  HHHHHHH :    
ExpBur          :bbbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebeebeeeebeebeebeeebebebeebbbbbbbbbeebbeeeebeeeeebbbbbbbebbeeee:    
Contact         :                                           a   a                                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123