#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2q6g assembly_id=1

Protein Model on 2q6g assembly_id=1 (TEMPLATE: 2q6g assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [305 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA 1S 2G 4R 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 170G 285A(T) 290E 299Q 302G 303V 304T 305F (identity: 96.6 %/95.7 %)
3 c C 1 (C) polymer(polypeptide(L)) [11 aa] Polypeptide chain 21T 24T 25T 26T 49M 54Y 67L 69Q 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 189Q 190T 191A (identity: 100.0 %/95.7 %)
4 d D 1 (D) polymer(polypeptide(L)) [8 aa] Polypeptide chain
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2q6g_A_1 identity=95.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ***** **** ****************** ******************** * ***** ******:
2q6g_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TT  SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :bb b bbbbbb  b      c  ccc                      c    c            c c                               

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2q6g_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :                     bbbbbbb        bbbcbcccc                 cccc c b c              c ccc         
Contact         :                                        c                                                           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2q6g_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHT  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebeebbeeeebeebeeebbeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebebbbbbebbebbe:    
Contact         :                                                                                    b    b        b 

queryA       301:SGVTF: 305
                :*****:
2q6g_A_1     301:SGVTF: 305
SecStr          :TT   :    
ExpBur          :eeeee:    
Contact         : bbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123