#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2q6g assembly_id=1

Protein Model on 2q6g assembly_id=1 (TEMPLATE: 2q6g assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [305 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 286L(I) 290E 299Q 300C 301S (identity: 97.0 %/95.7 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [302 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA
3 c C 1 (C) polymer(polypeptide(L)) [11 aa] Polypeptide chain
4 d D 1 (D) polymer(polypeptide(L)) [8 aa] Polypeptide chain 24T 25T 26T 27L 41H(A) 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 188R 189Q 190T 191A 192Q (identity: 96.0 %/95.7 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2q6g_B_1 identity=95.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ***** **** ****************** ******************** * ***** ******:
2q6g_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebeeeeebebbbebebeeebeebbe:    
Contact         :aaaaaaaaaaa  a         dddd             d       d    d                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2q6g_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeebeb:    
Contact         :                 a  aaaaaaaa        aaaaadddd                 ddda d   a              dddddd        
Contact         :                                       dd                        d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2q6g_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHGGG  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebbbbbbbebbeeee:    
Contact         :                                                                                     a   a        aa

queryA       301:SG: 302
                :**:
2q6g_B_1     301:SG: 302
SecStr          :H :    
ExpBur          :ee:    
Contact         :a                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123