#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2v6n assembly_id=1

Protein Model on 2v6n assembly_id=1 (TEMPLATE: 2v6n assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] REPLICASE POLYPROTEIN 1AB :R1AB_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 285A(T) 286L(I) 298R 299Q 300C 301S (identity: 93.8 %/96.1 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] REPLICASE POLYPROTEIN 1AB :R1AB_CVHSA
3 c B 1 (A) non-polymer(XP1) 4-(DIMETHYLAMINO)BENZOIC ACID
4 d B 2 (A) non-polymer(XP1) 4-(DIMETHYLAMINO)BENZOIC ACID 27L 39P 41H 49M 145C 164H 165M 187D 188R 189Q (identity: 100.0 %/96.1 %)
5 e C 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
6 f C 2 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 105R 134F(H) 181F 182Y 183G (identity: 80.0 %/96.1 %)
7 g D 1 (A) non-polymer(SO4) SULFATE ION
8 h D 2 (A) non-polymer(SO4) SULFATE ION 53N 56D (identity: 100.0 %/96.1 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2v6n_A_2 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2v6n_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbebbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeebbe:    
Contact         :aa aaaaaaaa  a            d           d d       d   h  h                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2v6n_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :    f         a      aaaaaaa     f  aaaaa   d                  dda     a        fff   ddd           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2v6n_A_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebbeeeebeeeebeebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                                                                    aa           aaa

queryA       301:SGVTFQ: 306
                :******:
2v6n_A_2     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    
Contact         :a                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123