#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2vj1 assembly_id=1

Protein Model on 2vj1 assembly_id=1 (TEMPLATE: 2vj1 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [300 aa] SARS CORONAVIRUS MAIN PROTEINASE :A7J8L3_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] SARS CORONAVIRUS MAIN PROTEINASE :A7J8L3_CVHSA 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 285A(T) 286L(I) 290E 299Q (identity: 92.6 %/96.0 %)
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 256Q (identity: 100.0 %/96.0 %)
4 d D 1 (A) non-polymer(BEZ) BENZOIC ACID 41H 49M 164H 165M 186V 187D 188R 189Q (identity: 100.0 %/96.0 %)
5 e E 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 5K 125V 127Q (identity: 100.0 %/96.0 %)
6 f F 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g G 1 (B) non-polymer(XP1) 4-(DIMETHYLAMINO)BENZOIC ACID
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2vj1_A_1 identity=96.0%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :********************************* ********** ****************** ******************** * ***** *******:
2vj1_A_1       1:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 100
SecStr          :  S      HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHHS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  EE:    
ExpBur          :beeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeeebeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebee:    
Contact         :bbbbbbbbbb  b                          d       d                                                    
Contact         :   e                                                                                                

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                :******************************** ********************************************* *********************:
2vj1_A_1     101:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 200
SecStr          :EE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B H:    
ExpBur          :eeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebbebb:    
Contact         :             b      bbbbbbb        bbb b                      dd                    dddd            
Contact         :                       e e                                                                          

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                : **************************************************************** *****************  ***************:
2vj1_A_1     201:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 300
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHTT :    
ExpBur          :bbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeebbbbbbbebbeeeee:    
Contact         :                                                      c                            bb   b        b  


Input Residue Numbers for Focused Sites

ex) 2,15,123