#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2yna assembly_id=1

Protein Model on 2yna assembly_id=1 (TEMPLATE: 2yna assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-LIKE PROTEINASE :R1A_BCHK4
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-LIKE PROTEINASE :R1A_BCHK4 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 115L 121S(K) 122P 123S(T) 124G 125V 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 284S(Q) 285A(S) 286L(T) 298R(M) 299Q (identity: 68.8 %/51.0 %)
3 c C 1 (A) non-polymer(NI) NICKEL (II) ION 27L 41H 145C (identity: 100.0 %/51.0 %)
4 d D 1 (A) non-polymer(IMD) IMIDAZOLE 27L 41H 145C (identity: 100.0 %/51.0 %)
5 e E 1 (A) non-polymer(GOL) GLYCEROL 6M 7A(S) 8F(A) 152I(E) 295D 298R(M) (identity: 33.3 %/51.0 %)
6 f F 1 (B) non-polymer(NI) NICKEL (II) ION
7 g G 1 (B) non-polymer(GOL) GLYCEROL 123S(T) (identity: 0.0 %/51.0 %)
8 h H 1 (B) non-polymer(GOL) GLYCEROL
9 i I 1 (B) non-polymer(GOL) GLYCEROL 11G 12K(A) 15G(N) (identity: 33.3 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2yna_A_1 identity=51.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
2yna_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGG SS  HHHHHHT  GGG EEE  SSS     EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbbebbbi bi           c             c                                                           
Contact         :     ee   i               d             d                                                           

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
2yna_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbebebbeeebeeebbbbbbbeeeeeebebbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                 b     bbbbbb          bbbbb   c      e             b  bb b                         
Contact         :                         g                     d                                                    

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
2yna_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebbbebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :                b                                                                      bbb        e 

queryA       297:VRQCSGVTFQ: 306
                :  *  **  *:
2yna_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHHH      :    
ExpBur          :beebeeeeee:    
Contact         : bb                                                                                                 
Contact         : e                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123