#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2z3e assembly_id=1

Protein Model on 2z3e assembly_id=1 (TEMPLATE: 2z3e assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab (pp1ab) :R1AB_CVHSA 134F(H) 184P 235M 245D 248D (identity: 80.0 %/96.1 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab (pp1ab) :R1AB_CVHSA
3 c B 1 (I) polymer(polypeptide(L)) [5 aa] ACE VAL Z3E LEU KCQ peptide
4 d B 2 (I) polymer(polypeptide(L)) [5 aa] ACE VAL Z3E LEU KCQ peptide 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 189Q 190T 192Q (identity: 100.0 %/96.1 %)
5 e C 1 (A) non-polymer(GOL) GLYCEROL
6 f C 2 (A) non-polymer(GOL) GLYCEROL 5K 7A 126Y 127Q (identity: 100.0 %/96.1 %)
7 g D 1 (A) non-polymer(GOL) GLYCEROL
8 h D 2 (A) non-polymer(GOL) GLYCEROL 63N 78I 79G 80H (identity: 100.0 %/96.1 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2z3e_A_2 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2z3e_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :    f f                                 d       d             h              hhh                    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2z3e_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                         ff      a     dddddd                 dddddd   d           a    dd d        

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2z3e_A_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebbbbbbbebbeeeb:    
Contact         :                                  a         a  a                                                    

queryA       301:SGVTFQ: 306
                :******:
2z3e_A_2     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123