#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2z94 assembly_id=1

Protein Model on 2z94 assembly_id=1 (TEMPLATE: 2z94 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 298R 299Q 300C 301S (identity: 93.9 %/96.1 %)
3 c B 1 (A) non-polymer(ZN) ZINC ION 41H 145C (identity: 100.0 %/96.1 %)
4 d B 2 (A) non-polymer(ZN) ZINC ION
5 e C 1 (A) non-polymer(TLD) 4-methylbenzene-1,2-dithiol 41H 142N 145C (identity: 100.0 %/96.1 %)
6 f C 2 (A) non-polymer(TLD) 4-methylbenzene-1,2-dithiol
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2z94_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2z94_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b                          c                                                           
Contact         :                                        e                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2z94_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                     bbbbbbb        bbbbbe  c                    b   b b                            
Contact         :                                            e                                                       

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2z94_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbeeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebbbbbbbebbeeeb:    
Contact         :                                                                                    bb   b       bbb

queryA       301:SGVTFQ: 306
                :******:
2z94_A_1     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123