#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2z9l assembly_id=1

Protein Model on 2z9l assembly_id=1 (TEMPLATE: 2z9l assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHSA 1S 2G 4R 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 285A(T) 286L(I) 290E 299Q 300C 301S 302G 303V 304T 305F (identity: 94.3 %/94.8 %)
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L 142N 144S 145C 163H 165M 166E 172H (identity: 100.0 %/94.8 %)
4 d D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 8F 127Q 295D 298R 299Q (identity: 100.0 %/94.8 %)
5 e E 1 (A) non-polymer(DAZ) diaminozinc 41H 145C (identity: 100.0 %/94.8 %)
6 f F 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g G 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/94.8 %)
8 h H 1 (B) non-polymer(DAZ) diaminozinc
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2z9l_A_1 identity=94.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** *********     *************** ******************** * ***** ******:
2z9l_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXXLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGG  -----    HHHHTTS  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbe-----eeeebeeebeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb b bbbbbb  b                          e                                                           
Contact         :     d d                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2z9l_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :              b      bbbbbbb        bbbbbc cc                 c cb     b                            
Contact         :                      g   d            cc   e                    c     c                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2z9l_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebee:    
Contact         :                                                                                    bb   b    d  dbb
Contact         :                                                                                                  d 

queryA       301:SGVTF: 305
                :*****:
2z9l_A_1     301:SGVTF: 305
SecStr          :TT   :    
ExpBur          :eeeee:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123