#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2zu2 assembly_id=1

Protein Model on 2zu2 assembly_id=1 (TEMPLATE: 2zu2 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVH22 1S(A) 2G 3F(L) 4R 5K 6M 7A 9P 10S 11G 14E 122P(A) 123S(Q) 124G 125V 126Y(F) 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 172H 280T(Q) 282L 285A(S) 286L(S) 298R(K) 299Q 302G (identity: 59.4 %/41.7 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVH22
3 c C 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 1S(A) (identity: 0.0 %/41.7 %)
4 d D 1 (A) non-polymer(DTZ) zinc(II)hydrogensulfide
5 e E 1 (B) non-polymer(DTZ) zinc(II)hydrogensulfide 41H 145C (identity: 100.0 %/41.7 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2zu2_B_1 identity=41.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICT-SEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  * * ****** * ********            *    *   ***    *   * * *  *    ** **   *  **:
2zu2_B_1       1:AGLRKMAQPSGFVEKCVVRVCYGNTVLNGLWLGDIVYCPRHVIASNTTSAIDYDHEYSIMRL--HNFSIISGTAFLGVVGATMHGVTLKIKVSQTNMHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS   HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEES   TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeebebeebeeebee--eebebbeeeeebeeeebeeeebbbebebeeebeeeb:    
Contact         :aaaaaaa aaa  a                          e                                                           
Contact         :c                                                                                                   

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :   *     *  *  **** *   **    ** * ** *** ** *** * *     * * ***  **  * * *    *  ** * *    *       :
2zu2_B_1      99:RHSFRTLKSGEGFNILACYDGCAQGVFGVNMRTNWTIRGSFINGACGSPGYNLKNGEVEFVYMHQIELGSGSHVGSSFDGVMYGGFEDQPNLQVESANQM: 198
SecStr          :SEEE    TT EEEEEEESSSSEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeee:    
Contact         :                      aaaaaaa        aaaaa   e                    a     a                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : **** * ****  **  * *          *  *             *    * * **  *          * **  *  ***   * ***    ** *:
2zu2_B_1     199:LTVNVVAFLYAAILNGCTWWLKGEKLFVEHYNEWAQANGFTAMNGE--DAFSILAAKTGVCVERLLHAI-QVLNNGFGGKQILGYSSLNDEFSINEVVKQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      --HHHHHHHHHHS  HHHHHHHH-HHHTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebeeeeebebeebeebbeeeebbebeee--ebbeebbeeeebebeebbebb-eebeeebeeeebeeeeebbbebbbebbbee:    
Contact         :                                                                                a a  aa           aa

queryA       300:CSGVTF: 305
                :  **  :
2zu2_B_1     296:MFGVNL: 301
SecStr          :HH    :    
ExpBur          :eeeeee:    
Contact         :  a                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123