#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23 assembly_id=1

Protein Model on 3d23 assembly_id=1 (TEMPLATE: 3d23 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1 221N(Q) 222R(N) 223F(D) 270E(R) 273Q(M) 277N(Q) 279R (identity: 14.3 %/49.3 %)
2 b B 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 2G 4R(V) 5K 6M 7A(V) 9P 10S(T) 11G(S) 14E 121S(R) 122P 123S(Q) 124G 125V(A) 126Y(F) 137K 138G 139S 141L 169T 170G 171V(C) 215G(N) 280T(Q) 285A(C) 286L(T) 298R(Q) 299Q 300C(L) (identity: 48.3 %/49.3 %)
3 c A(queryA) C 1 (C) polymer(polypeptide(L)) [298 aa] 3C-like proteinase :R1AB_CVHN1
4 d D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 224T(V) (identity: 0.0 %/49.3 %)
5 e E 1 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
6 f F 1 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
7 g G 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 24T(S) 25T(M) 26T 27L 41H 140F 143G 144S 145C 163H 164H(Q) 165M(L) 166E 167L 172H 187D 189Q 190T(V) 191A(V) 192Q (identity: 70.0 %/49.3 %)
8 h H 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:3d23_C_1 identity=49.3%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :*  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ****:
3d23_C_1       4:GIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKY: 103
SecStr          :         TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  TTTSSS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :eeeeeeeeeeebeebbbbbbbeebebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebeeeeeebebeeeeeeebbbbbbbeeebeeebee:    
Contact         :b bbbb bbb  b         gggg             g                                                            

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                : *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   *:
3d23_C_1     104:TFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQT: 203
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B H:    
ExpBur          :eebebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeebb:    
Contact         :                   bbbbbb          bbbgb ggg                 ggggg bbbg              g gggg         

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :*** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  *  :
3d23_C_1     204:VNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLA: 300
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHTT-  TT  SSS SS   SS HHHHHHHHT:    
ExpBur          :bbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeee--beebbeeeebebebbbbbbeebee-ebeeeebeeeeebebbbbbebbeeeee:    
Contact         :             b     aaad                                             a  a   a ab    bb           bbb 

queryA       302:G: 302
                :*:
3d23_C_1     301:G: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123