#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23 assembly_id=1

Protein Model on 3d23 assembly_id=1 (TEMPLATE: 3d23 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description d(query A)
1 a A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1 46S 49M 50L(N) 142N(C) 166E 170G 172H 189Q (identity: 75.0 %/49.5 %)
2 b B 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1
3 c C 1 (C) polymer(polypeptide(L)) [298 aa] 3C-like proteinase :R1AB_CVHN1 23G (identity: 100.0 %/49.5 %)
4 d A(queryA) D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1
5 e E 1 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
6 f F 1 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
7 g G 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
8 h H 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 24T(S) 25T(M) 26T 27L 41H 49M 140F 141L 142N(C) 143G 144S 145C 163H 164H(Q) 165M(L) 166E 172H 187D 189Q 190T(V) 191A(V) 192Q (identity: 68.2 %/49.5 %)
ALIGNMENTS
MODEL[4] Protein A "queryA" TEMPLATE:3d23_D_1 identity=49.5%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_D_1       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          :-         TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHGGG  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :-eeeeeeeeeeebeebbbbbbbeeeebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebebeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :                      chhhh             h    a  aa                                                  
Contact         :                                                h                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_D_1     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeebebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                                       hhahhh                 hhha   a a              h ahhh        
Contact         :                                         h                       h     h                h           

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_D_1     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHTT-  TT  SSS SS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeee--beebbeeeebebebbbbbbeebee-ebeeeebeeeeebebebbbebbeeee:    

queryA       301:SG: 302
                : *:
3d23_D_1     300:AG: 301
SecStr          :T :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123