#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm assembly_id=1

Protein Model on 3iwm assembly_id=1 (TEMPLATE: 3iwm assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description e(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 3F 4R 5K 6M 8F 109G 111T 127Q 129A 131R 132P 197D 198T 199T 200I 201T 202V(L) 203N 204V 205L 206A 207W 208L 209Y 210A 211A 212V 213I 216D 218W 219F 220L 222R 223F 238N 239Y 240E 249I 250L 253L 254S 256Q 257T 259I 260A 261V 263D 264M 266A 267S(A) 268L 270E 271L 273Q 274N 276M 279R 280T 281I 282L 284S 287L 288E 289D 290E 291F 292T 293P 295D 296V 298R 299Q (identity: 97.2 %/96.0 %)
2 b A 2 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
3 c B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 290E 298R 299Q 300C (identity: 100.0 %/96.0 %)
4 d B 2 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 123S 124G 139S 141L (identity: 100.0 %/96.0 %)
5 e A(queryA) C 1 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
6 f C 2 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 228N 229D 231N 232L 235M 236K 238N (identity: 100.0 %/96.0 %)
7 g D 1 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 285A(T) 286L(I) (identity: 0.0 %/96.0 %)
8 h D 2 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 166E 172H (identity: 100.0 %/96.0 %)
9 i E 1 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
10 j E 2 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
11 k F 1 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
12 l F 2 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
13 m G 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 25T 27L 41H 49M 140F 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 187D 188R 189Q 190T 191A (identity: 100.0 %/96.0 %)
14 n G 2 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
15 o H 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
16 p H 2 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 1S (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[5] Protein A "queryA" TEMPLATE:3iwm_C_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_C_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         SHHHHTTEEEEE SS EEEEEEETTEEE  TTTT  TTS SS  SSSSTTTS GGG EEEETTEEE    EEEETTEEEEE SS  TT  S:    
ExpBur          :eeeeeeeeebeebeebbbebbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebeebeeeebbbebebeeebeeebe:    
Contact         :hhaaaahahhh  h          m m             m       m                                                   
Contact         :p  hhh h                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3iwm_C_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE STT EEEEEEEEEE TTS EEEE TTS BSSS  SS SS         :    
ExpBur          :eeeeebeebeebbbbbbbebeeeeeebbebbebebbeeebeebbbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :        a a          hddhhaha aa    hhdhdmmmm                 mmmhmm   h              mmmmm     aaaa
Contact         :                      hh  h           hm                         m     m                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3iwm_C_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  GGGS     STTTGGGHHHH      HHHHHHHHHHHHHHT  HHHHHHHHHHHHTT  TT  BTTBSS   S  TTHHHHH :    
ExpBur          :eeeeeeeeebbbeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeebeeeeeeebeeebbebbeebeeebeeeeeeebeeeeeeeeeeeeeeee:    
Contact         :aaaaaaaaaaaaa  a aaa aa    ff ff  ff aaa        aa  aa aa aaa aa aaa aa aa a  aaaa aggaaaaaaa aa aac
Contact         :                                     f                                                   c       cc 


Input Residue Numbers for Focused Sites

ex) 2,15,123