#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm assembly_id=1

Protein Model on 3iwm assembly_id=1 (TEMPLATE: 3iwm assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description h(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 4R 123S 139S 141L (identity: 100.0 %/96.0 %)
2 b A 2 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 298R 299Q 300C (identity: 100.0 %/96.0 %)
3 c B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
4 d B 2 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 3F 4R 5K 6M 8F 109G 110Q 111T 127Q 129A 131R 132P 197D 198T 199T 200I 201T 202V(L) 203N 204V 205L 206A 207W 208L 209Y 210A 211A 212V 213I 214N 216D 218W 219F 220L 221N 223F 238N 239Y 240E 242L 246H 249I 250L 253L 256Q 257T 259I 260A 261V 263D 264M 266A 267S(A) 268L 271L 276M 277N 279R 280T 281I 282L 287L 288E 289D 290E 291F 292T 293P 295D 296V 298R 299Q (identity: 97.2 %/96.0 %)
5 e C 1 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 3F 4R 5K 6M 7A 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 166E 170G 172H (identity: 100.0 %/96.0 %)
6 f C 2 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 283G 285A(T) 286L(I) (identity: 33.3 %/96.0 %)
7 g D 1 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
8 h A(queryA) D 2 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
9 i E 1 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
10 j E 2 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
11 k F 1 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
12 l F 2 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
13 m G 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 1S (identity: 100.0 %/96.0 %)
14 n G 2 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
15 o H 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
16 p H 2 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 26T 27L 41H 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 187D 188R 189Q 190T 191A 192Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[8] Protein A "queryA" TEMPLATE:3iwm_D_2 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_D_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEB EETTEE  EE  TT  B BTTTT  STTSSS   TT  SSSTTTS   EETTEE  B   B  TTB B  BSS  TT   :    
ExpBur          :eeeeeeeeebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeeeeeebeeeebebbbeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :eedaddedeee  e           pp             p                                                           
Contact         :m edee                                                                                              
Contact         :   e                                                                                                

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3iwm_D_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :B      TT B EEEEESSS EEEEE  B  TTS B     TT TT EEE  STTSB   EEEEE  SSS BEEE SSS BSSS  SS S          :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeeebebbebebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeebeeeeeb:    
Contact         :        ddd          eaeeeded dd    eeaeapppp                 pppepp e e              pppppp    dddd
Contact         :                      e   e           epp                        p     p                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3iwm_D_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT    SSTT   HHHHHHHHTTSS     HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  SS  BTTBSS   S  HHHHHHT :    
ExpBur          :eeeeeeeeebbeeeeeeeeeeeeebeeeebeebbeeeeeeebeeeebeeeeebeeeeeeebeeebbeebeebeeebeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :dddddddddddddd d dddd d              ddd d   d  dd  d  dd ddd dd ddd  d    dd ddddf ffddddddd dd bbb
Contact         :                                                                                                 dd 


Input Residue Numbers for Focused Sites

ex) 2,15,123