#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3sna assembly_id=1

Protein Model on 3sna assembly_id=1 (TEMPLATE: 3sna assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 298R 299Q 301S (identity: 93.9 %/96.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
3 c B 1 (H) polymer(polypeptide(L)) [6 aa] Peptide aldehyde inhibitor Ac-NSFSQ-H
4 d B 2 (H) polymer(polypeptide(L)) [6 aa] Peptide aldehyde inhibitor Ac-NSFSQ-H 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 187D 190T 191A 192Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:3sna_A_2 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3sna_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHT  TTT EEEETTEEE B   EEETTEEEEEBS   TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeebeebebeeeeeebebeeeeeeebbbebebeeebeeeee:    
Contact         :aa aaaaaaaa  a                          d       d                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3sna_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeeeeb:    
Contact         :              a      aaaaaaa        aaaaadddd                 ddda d a a              d  ddd        
Contact         :                                       dd                        d                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3sna_A_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHHTTSS  BTTBSS  TT  HHHHHHH :    
ExpBur          :bbbbbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbeebbeeebeeeebeeeeebebbbbbebbeeeb:    
Contact         :                                                                                    aa   a       aa 

queryA       301:S: 301
                :*:
3sna_A_2     301:S: 301
SecStr          : :    
ExpBur          :e:    
Contact         :a                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123