#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3snd assembly_id=1

Protein Model on 3snd assembly_id=1 (TEMPLATE: 3snd assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 3F 4R 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 298R 299Q 300C 301S (identity: 94.3 %/96.1 %)
3 c C 1 (C) polymer(polypeptide(L)) [2 aa] Peptide aldehyde inhibitor Ac-ESTLQ-H 41H 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H (identity: 100.0 %/96.1 %)
4 d D 1 (D) polymer(polypeptide(L)) [2 aa] Peptide aldehyde inhibitor Ac-ESTLQ-H
5 e E 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 108P 109G 132P 200I 202V(L) 246H (identity: 83.3 %/96.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3snd_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3snd_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :bbbb bbbbbb  b                          c                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3snd_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSSS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbbebebeeeebeeeebbeb:    
Contact         :       ee        b  bbbbbbbb   e    bbbbbcccc                 cccb   b b                           e
Contact         :                                       cc                        c     c                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3snd_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeeeb:    
Contact         : e                                           e                                      bb   b       bbb

queryA       301:SGVTFQ: 306
                :******:
3snd_A_1     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123