#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3tit assembly_id=1

Protein Model on 3tit assembly_id=1 (TEMPLATE: 3tit assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] SARS coronavirus main protease :R1A_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] SARS coronavirus main protease :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 285A(T) 286L(I) 290E 298R 299Q 301S (identity: 93.3 %/96.1 %)
3 c B 1 (A) non-polymer(G81) ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALANYL]AMINO}-5-[(3S)-2-OXOPYRROLIDIN-3-YL]PENTANOATE 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 187D 188R 189Q (identity: 100.0 %/96.1 %)
4 d B 2 (A) non-polymer(G81) ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALANYL]AMINO}-5-[(3S)-2-OXOPYRROLIDIN-3-YL]PENTANOATE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tit_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3tit_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b                                  c                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3tit_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                     bbbbbb         bbbbbcccc                 cccb     b              ccc           
Contact         :                                       cc                        c     c                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3tit_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebbeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeeeb:    
Contact         :                                                                                    bb   b       bb 

queryA       301:SGVTFQ: 306
                :******:
3tit_A_1     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123