#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3tlo assembly_id=1

Protein Model on 3tlo assembly_id=1 (TEMPLATE: 3tlo assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1A_CVHNL
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1A_CVHNL 1S 2G 4R(K) 6M 7A 9P 10S 11G 14E 15G(R) 122P(A) 123S 124G 125V 126Y(F) 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 284S(Y) 285A(S) 286L(S) 298R(K) 299Q 300C(M) 301S(Y) 302G (identity: 61.3 %/44.9 %)
3 c C 1 (A) non-polymer(GOL) GLYCEROL 5K 6M 8F(Q) 111T(S) 112F 113S(N) 127Q(G) 151N 295D(E) (identity: 44.4 %/44.9 %)
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 32L 33D(G) 94A(S) 95N 98T 101Y(H) (identity: 50.0 %/44.9 %)
5 e E 1 (A) non-polymer(GOL) GLYCEROL 202V(D) 243T(S) 249I(C) 250L(Y) 305F(L) (identity: 0.0 %/44.9 %)
6 f F 1 (B) non-polymer(GOL) GLYCEROL 123S (identity: 100.0 %/44.9 %)
7 g G 1 (B) non-polymer(GOL) GLYCEROL 118Y 123S 141L(I) (identity: 66.7 %/44.9 %)
8 h H 1 (B) non-polymer(GOL) GLYCEROL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3tlo_A_1 identity=44.9%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
3tlo_A_1       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  S SS -  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eeeebeeeebeebeebbbebbbeeeebbbbbbeeebbbbbebbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebebeebbbebebeeebeeebe:    
Contact         :bb bcbbcbbb  bb                dd                                                            dd  d  
Contact         :     c                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
3tlo_A_1     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSS         B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :d         ccc    g   bbbbbb         bbbbb         c               b     b                           
Contact         :                      f   c             g                                                           
Contact         :                      g                                                                             

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
3tlo_A_1     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT       HHHHHHHHHHHTB     --SGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbebbeeeebbebee--beebeebeeebebebeebbbbbee-beeebeeeebeeeeebbbebbbebbbee:    
Contact         :  e                                        e     ee                                 bbb        c  bb

queryA       300:CSGVTF: 305
                :  **  :
3tlo_A_1     297:MYGVNL: 302
SecStr          :HHS   :    
ExpBur          :eeeeee:    
Contact         :bbb  e                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123