#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3v3m assembly_id=1

Protein Model on 3v3m assembly_id=1 (TEMPLATE: 3v3m assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 299Q 300C 301S (identity: 93.8 %/96.1 %)
3 c B 1 (A) non-polymer(0EN) N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)ethyl]-N-(4-tert-butylphenyl)furan-2-carboxamide 25T 26T 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 187D (identity: 100.0 %/96.1 %)
4 d B 2 (A) non-polymer(0EN) N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)ethyl]-N-(4-tert-butylphenyl)furan-2-carboxamide
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 22C 23G 24T 25T 42V 44C 45T 46S(A) (identity: 87.5 %/96.1 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 40R 84N 85C (identity: 100.0 %/96.1 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3v3m_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3v3m_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SS SSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b       eeecc             gce eee  c                                  gg               
Contact         :                        e                                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3v3m_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeeb:    
Contact         :                     bbbbbbb        bbbbbcccc                 cccb   b b              c             
Contact         :                                       cc                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3v3m_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH   S  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebbbbbbbebbeeeb:    
Contact         :                                                                                    bb   b        bb

queryA       301:SGVTFQ: 306
                :******:
3v3m_A_1     301:SGVTFQ: 306
SecStr          : SS  -:    
ExpBur          :eeeee-:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123