#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3vb4 assembly_id=1

Protein Model on 3vb4 assembly_id=1 (TEMPLATE: 3vb4 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 299Q 302G 303V 304T 305F (identity: 94.4 %/96.1 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA
3 c C 1 (E) polymer(polypeptide(L)) [5 aa] B4Z inhibitor 1S (identity: 100.0 %/96.1 %)
4 d D 1 (F) polymer(polypeptide(L)) [5 aa] B4Z inhibitor 41H 49M 54Y 140F 141L 143G 144S 145C 163H 164H 165M 166E 167L 172H 187D 189Q 190T 191A (identity: 100.0 %/96.1 %)
5 e E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 5K 126Y 127Q (identity: 100.0 %/96.1 %)
6 f F 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
7 g G 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
8 h H 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 105R 106I 107Q 108P 182Y (identity: 100.0 %/96.1 %)
9 i I 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 245D 248D (identity: 100.0 %/96.1 %)
10 j J 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 11G 14E 15G 97K (identity: 100.0 %/96.1 %)
11 k K 1 (B) non-polymer(GOL) GLYCEROL 108P 200I 240E 246H (identity: 100.0 %/96.1 %)
12 l L 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 247V 254S 260A 261V 262L (identity: 100.0 %/96.1 %)
13 m M 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 133N 134F(H) 184P 185F 194A 195G (identity: 83.3 %/96.1 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:3vb4_B_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3vb4_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGGGS  HHHHHHH  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbebbbeebebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  aj                         d       d    d                                          j   
Contact         :c   e     j  j                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3vb4_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :    hhhh      a      aaaaaaa    mm  aaaaa ddd                 dddad  a a         h mm d ddd  mm    k
Contact         :       k                 ee            dd                        d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3vb4_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeeeeebeebbeeeebebeebbbbbeebbeeebeeeebbeeeebbbbbbbebbebee:    
Contact         :                                       k    ikli     l     lll                      aa   a        a 

queryA       301:SGVTFQ: 306
                :******:
3vb4_B_1     301:SGVTFQ: 306
SecStr          :TT    :    
ExpBur          :eeeeee:    
Contact         : aaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123