#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3vb6 assembly_id=1

Protein Model on 3vb6 assembly_id=1 (TEMPLATE: 3vb6 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 172H 285A(T) 286L(I) 290E 299Q 301S (identity: 93.8 %/96.0 %)
3 c C 1 (E) polymer(polypeptide(L)) [4 aa] C6Z inhibitor 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 187D 188R 189Q 190T 192Q (identity: 100.0 %/96.0 %)
4 d D 1 (F) polymer(polypeptide(L)) [4 aa] C6Z inhibitor 1S (identity: 100.0 %/96.0 %)
5 e E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 105R 134F(H) 183G (identity: 66.7 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3vb6_A_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3vb6_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEEEEEEEEEGGGS  TTGGGS  HHHHHHT  GGG EEEETTEEE EEE  EETTEEEEEEEEEETT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :bbbbbbbbbbb  b                          c       c                                                   
Contact         :d                                                                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3vb6_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeeb:    
Contact         :    e               bbbbbbbb     e  bbbbbcccc                 cccb     b          e   cccc c        
Contact         :                                       cc                        c     c                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3vb6_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                                                                    bb   b        b 

queryA       301:S: 301
                :*:
3vb6_A_1     301:S: 301
SecStr          : :    
ExpBur          :e:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123