#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3vb7 assembly_id=1

Protein Model on 3vb7 assembly_id=1 (TEMPLATE: 3vb7 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 299Q 302G 303V 304T 305F (identity: 94.1 %/96.1 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA
3 c C 1 (E) polymer(polypeptide(L)) [4 aa] M4Z inhibitor 1S (identity: 100.0 %/96.1 %)
4 d D 1 (F) polymer(polypeptide(L)) [4 aa] M4Z inhibitor 41H 49M 140F 141L 143G 144S 145C 163H 164H 165M 166E 172H 187D 188R 189Q 190T 192Q (identity: 100.0 %/96.1 %)
5 e E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
6 f F 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 105R 134F(H) 182Y 183G (identity: 75.0 %/96.1 %)
7 g G 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 218W 219F 220L 270E 279R (identity: 100.0 %/96.1 %)
8 h H 1 (B) non-polymer(GOL) GLYCEROL 133N 134F(H) 184P 185F 194A 195G (identity: 83.3 %/96.1 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:3vb7_B_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
3vb7_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a                          d       d                                                   
Contact         :c                                                                                                   

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
3vb7_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebbeb:    
Contact         :    f                aaaaaaa    hf  aaaaa ddd                 ddda   a a         ffhh dddd d hh     
Contact         :                                 h     dd                        d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
3vb7_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbeebbeeebeeeebbeeeebbbbbbbebbebee:    
Contact         :                 ggg                                                 g        g     aa   a        a 

queryA       301:SGVTFQ: 306
                :******:
3vb7_B_1     301:SGVTFQ: 306
SecStr          :TT    :    
ExpBur          :eeeeee:    
Contact         : aaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123