#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4mds assembly_id=1

Protein Model on 4mds assembly_id=1 (TEMPLATE: 4mds assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [303 aa] 3C-like proteinase :R1A_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [303 aa] 3C-like proteinase :R1A_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 290E 298R 299Q 300C 301S (identity: 93.8 %/95.7 %)
3 c B 1 (A) non-polymer(23H) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-[(2-methylbutan-2-yl)amino]-1-(1-methyl-1H-pyrrol-2-yl)-2-oxoethyl]acetamide 41H 44C 45T 46S(A) 49M 140F 141L 142N 144S 145C 163H 164H 165M 166E 167L 168P 188R 189Q (identity: 94.4 %/95.7 %)
4 d B 2 (A) non-polymer(23H) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-[(2-methylbutan-2-yl)amino]-1-(1-methyl-1H-pyrrol-2-yl)-2-oxoethyl]acetamide
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 22C 23G 24T 25T 42V 43I 44C (identity: 100.0 %/95.7 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 40R 84N 85C (identity: 100.0 %/95.7 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4mds_A_1 identity=95.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
4mds_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b       eeee              gceeccc  c                                  gg               
Contact         :                                           e                                                        

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
4mds_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                     bbbbbb         bbbbbc cc                 cccbcc b b               cc           
Contact         :                                       cc                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
4mds_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebeebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeebe:    
Contact         :                                                                                    bb   b       bbb

queryA       301:SGV: 303
                :** :
4mds_A_1     301:SGA: 303
SecStr          :   :    
ExpBur          :eee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123