#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4rsp assembly_id=1

Protein Model on 4rsp assembly_id=1 (TEMPLATE: 4rsp assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] Orf1a protein :V9TU12_9BETC
2 b A 2 (A) polymer(polypeptide(L)) [304 aa] Orf1a protein :V9TU12_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 299Q 300C(I) 302G (identity: 69.7 %/52.2 %)
3 c B 1 (B) polymer(polypeptide(L)) [5 aa] Peptide inhibitor 41H 49M(L) 140F 141L 142N(U) 143G 144S 145C 163H 164H(Q) 165M 166E 167L 172H 187D 188R(K) 189Q 190T(V) 191A(H) 192Q (identity: 70.0 %/52.2 %)
4 d B 2 (B) polymer(polypeptide(L)) [5 aa] Peptide inhibitor
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rsp_A_1 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4rsp_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TT  SS  HHHHHHT  GGGEEEEE SSS EE  EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebebbbbbbebeebebbbbbbeebbbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b                          c       c                                                   

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4rsp_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLUGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        bbbbb          bbbbbcccc                 cccbc bb b              cccccc     
Contact         :                                          cc                        c     c                         

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4rsp_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHH   HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :                b                                                                     bbbb          

queryA       297:VRQCSGV: 303
                :  *  **:
4rsp_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebbbee:    
Contact         :  bb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123