#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wme assembly_id=1

Protein Model on 4wme assembly_id=1 (TEMPLATE: 4wme assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] MERS-CoV 3CL protease :W6A941_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 168P(A) 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 299Q 301S(M) (identity: 66.7 %/51.7 %)
3 c E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 218W 219F 221N(K) 266A(Y) 270E(Q) 277N(Q) (identity: 33.3 %/51.7 %)
4 d F 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 215G 216D(C) 217R(A) 218W (identity: 50.0 %/51.7 %)
5 e G 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 131R 197D 198T(K) 199T(Y) (identity: 50.0 %/51.7 %)
6 f H 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 166E 167L 168P(A) 169T(N) (identity: 50.0 %/51.7 %)
7 g I 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 19Q 69Q 119N 120G (identity: 100.0 %/51.7 %)
8 h J 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 134F(Y) 182Y 183G 184P(A) (identity: 50.0 %/51.7 %)
9 i K 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 216D(C) 280T(Q) 281I 282L 283G (identity: 60.0 %/51.7 %)
10 j L 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 5K 6M 7A(S) 125V(T) 126Y(F) (identity: 40.0 %/51.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wme_A_1 identity=51.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wme_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEEE SSS EE  EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeebebebebeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b    g                                                 gggg                            
Contact         :    jjj                                                                                             

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wme_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbebebeeebbbbbbbeeeeeebbbbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                     gg bbbbb    e  h  bbbbb                        bfbbb b         hhh            e
Contact         :                           jj                                       f ff                            

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wme_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HHHHH---HHHHH   HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :ee              bdddcc c                                             c   c      c  iiibbbb          
Contact         :                  i d                                                                 i             

queryA       297:VRQCSGVTFQ: 306
                :  *  **  *:
4wme_A_1     297:NMQIMGVVMQ: 306
SecStr          :HHHT      :    
ExpBur          :bebbeeeeee:    
Contact         :  b b                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123