#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmf assembly_id=1

Protein Model on 4wmf assembly_id=1 (TEMPLATE: 4wmf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 299Q 300C(I) 301S(M) (identity: 66.7 %/51.8 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [303 aa] MERS-CoV 3CL protease :W6A941_9BETC
3 c C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
6 f F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
7 g G 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 41H 49M(L) 140F 141L 142N(C) 144S 163H 164H(Q) 165M 166E 188R(K) 189Q (identity: 66.7 %/51.8 %)
8 h H 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 118Y 123S(T) (identity: 50.0 %/51.8 %)
9 i I 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 131R 197D 198T(K) 199T(Y) 238N(Q) (identity: 40.0 %/51.8 %)
10 j J 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 101Y 102K(T) 103F (identity: 66.7 %/51.8 %)
11 k K 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 166E 167L 189Q 190T(V) 191A(H) (identity: 60.0 %/51.8 %)
12 l L 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 6M 7A(S) 8F(H) 298R(M) (identity: 25.0 %/51.8 %)
13 m M 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
14 n N 1 (C) non-polymer(PG4) TETRAETHYLENE GLYCOL
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4wmf_B_1 identity=51.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmf_B_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeeeeebebeebeeebeeeebebebeeeeeeebebebeeeeebbbebebeeebee:    
Contact         :aa aaaaaaaa  a                          g       g                                                   
Contact         :     lll                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmf_B_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :   jjj              h   aaaaa    i     aaaaag g                  gggak aa a               ggkk     i
Contact         :                         h                gg                        g                      k        
Contact         :                                                                    k                               

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmf_B_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeeebee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :ii              a                       i                                             aaaa          

queryA       297:VRQCSGV: 303
                :  *  **:
4wmf_B_1     297:NMQIMGV: 303
SecStr          :HHHHS  :    
ExpBur          :bebebee:    
Contact         : laaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123