#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmf assembly_id=1

Protein Model on 4wmf assembly_id=1 (TEMPLATE: 4wmf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 210A 213I(L) 214N 299Q 300C(I) 302G 303V 304T(V) 305F(M) 306Q (identity: 60.0 %/51.0 %)
2 b B 1 (B) polymer(polypeptide(L)) [303 aa] MERS-CoV 3CL protease :W6A941_9BETC
3 c A(queryA) C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
6 f F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
7 g G 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
8 h H 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
9 i I 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
10 j J 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
11 k K 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
12 l L 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
13 m M 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 101Y 102K(T) 103F (identity: 66.7 %/51.0 %)
14 n N 1 (C) non-polymer(PG4) TETRAETHYLENE GLYCOL 35V(T) 37Y(W) 83Q 88K (identity: 50.0 %/51.0 %)
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:4wmf_C_1 identity=51.0%
queryA        11:GKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQ: 107
                :* ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** ** * *    :
4wmf_C_1      11:GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADXXXDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVK: 110
SecStr          : TTGGGEEEEEETTEEEEEEEETTEEEEEGGGGS   ---   HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT  SEEE    :    
ExpBur          :eebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeee---ebebeebeeebeeeebebebbeeeeeebebeeeeeeebbbebebeeebeebbeeeeeebe:    
Contact         :                        n n                                                n    n            mmm    

queryA       108:PGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAW: 207
                :**  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *      **    *** **:
4wmf_C_1     111:PGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAXGTHTGSAFDGTMYGAFMDKQVXXXQLTDKYCSVNVVAW: 210
SecStr          :TT EEEEEEEETTEEEEEEEEEB TTS EE    TT TT EEEEEETTEEEEEEEEEEE  - EEEEE TTS BGGG   S  ---    SB HHHHHHH:    
ExpBur          :eeeebebbbbbebeebbebebebeeeebbebbbbeebbbbbbbeeeeeebebbbbbbbeee-ebbbbbbbebebbeeeebbee---eeeeebebbbbbbb:    

queryA       208:LYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ: 306
                :****  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **  *  **  *:
4wmf_C_1     211:LYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ: 306
SecStr          :HHHHHHHT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS      HHHHHHHHHT    :    
ExpBur          :bbbbbeeebeebeeeeebeeeebbeebeeebbeebeeeebbee---bbeebebbbebbbebbbebb-ebbeeeebeebbbbbeeeebeebbeeeeeeeee:    
Contact         :  a  aa                                                                                     aa aaaaa


Input Residue Numbers for Focused Sites

ex) 2,15,123