#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ylu assembly_id=1

Protein Model on 4ylu assembly_id=1 (TEMPLATE: 4ylu assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] ORF1a protein :A0A0A7E693_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] ORF1a protein :A0A0A7E693_9BETC 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 284S 285A(T) 286L(M) 299Q 300C(I) 302G (identity: 71.9 %/52.2 %)
3 c E 1 (A) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 25T(M) 41H 49M(L) 54Y 140F 141L 142N(C) 145C 163H 164H(Q) 165M 166E 187D 188R(K) 189Q (identity: 66.7 %/52.2 %)
4 d F 1 (A) non-polymer(ACT) ACETATE ION 103F 104V(T) 105R(T) 176D(A) 178E(D) (identity: 20.0 %/52.2 %)
5 e G 1 (A) non-polymer(ACT) ACETATE ION 197D 199T(Y) (identity: 50.0 %/52.2 %)
6 f H 1 (B) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 1S (identity: 100.0 %/52.2 %)
7 g I 1 (B) non-polymer(ACT) ACETATE ION
8 h J 1 (B) non-polymer(ACT) ACETATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ylu_A_1 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4ylu_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeeeebbbbbbeeebbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b          c               c       c    c                                              
Contact         :f                                                                                                   

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4ylu_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  EEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :     ddd                bbbbb          bbbbbc  c                 cccb  bb b   d d        ccc       e
Contact         :                                          cc                        c                               

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4ylu_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeebbee---bbeebebbbbbbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         : e              b                                                                     bbbb          

queryA       297:VRQCSGV: 303
                :  *  **:
4ylu_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         :  bb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123