#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yo9 assembly_id=1

Protein Model on 4yo9 assembly_id=1 (TEMPLATE: 4yo9 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_BCHK4 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 121S(K) 122P 123S(T) 124G 125V 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 284S(Q) 286L(T) 298R(M) 299Q 301S(M) (identity: 67.7 %/51.0 %)
3 c C 1 (A) non-polymer(ZN) ZINC ION 27L 41H 145C (identity: 100.0 %/51.0 %)
4 d D 1 (A) non-polymer(ACT) ACETATE ION 197D 199T(Y) (identity: 50.0 %/51.0 %)
5 e E 1 (A) non-polymer(ACT) ACETATE ION 118Y 139S 140F 141L (identity: 100.0 %/51.0 %)
6 f F 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 123S(T) (identity: 0.0 %/51.0 %)
7 g G 1 (A) non-polymer(SIN) SUCCINIC ACID 11G 15G(N) (identity: 50.0 %/51.0 %)
8 h H 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 224T(R) 260A(S) 262L(E) (identity: 0.0 %/51.0 %)
9 i I 1 (B) non-polymer(ACT) ACETATE ION
10 j J 1 (B) non-polymer(ACT) ACETATE ION
11 k K 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL
12 l L 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL
13 m M 1 (B) non-polymer(FMT) FORMIC ACID
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yo9_A_1 identity=51.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yo9_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  TTS EEEB SSS B   EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebeeeeeeeebebebeeeeebebebeeeebeebbbebebeeebee:    
Contact         :bb bbbb bbb  bg           c             c                                                           
Contact         :          g                                                                                         

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yo9_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebebeeeebbbbbebebbebebeeebbbbbbbeeeeeebebbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                    e  bbbbbb          bbbbb   c                    b  bb b                        d
Contact         :                         f               eee                                                        

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yo9_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeeeebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         : d              b         h                                    h h                     b b          

queryA       297:VRQCSGVTFQ: 306
                :  *  **  *:
4yo9_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHHS      :    
ExpBur          :bebbeeeeee:    
Contact         : bb b                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123