#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yo9 assembly_id=1

Protein Model on 4yo9 assembly_id=1 (TEMPLATE: 4yo9 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 122P 123S(T) 124G 125V 126Y(F) 137K 138G 139S 140F 141L 152I(E) 166E 169T(N) 170G 172H 214N 284S(Q) 285A(S) 299Q (identity: 72.4 %/51.2 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_BCHK4
3 c C 1 (A) non-polymer(ZN) ZINC ION
4 d D 1 (A) non-polymer(ACT) ACETATE ION
5 e E 1 (A) non-polymer(ACT) ACETATE ION 6M 298R(M) 299Q (identity: 66.7 %/51.2 %)
6 f F 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 7A(S) 298R(M) (identity: 0.0 %/51.2 %)
7 g G 1 (A) non-polymer(SIN) SUCCINIC ACID 11G 14E 15G(N) 70A(G) (identity: 50.0 %/51.2 %)
8 h H 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL
9 i I 1 (B) non-polymer(ACT) ACETATE ION 131R 197D 198T(K) 199T(Y) (identity: 50.0 %/51.2 %)
10 j J 1 (B) non-polymer(ACT) ACETATE ION 297V(N) 298R(M) (identity: 0.0 %/51.2 %)
11 k K 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL 105R(T) 178E(D) (identity: 0.0 %/51.2 %)
12 l L 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL 6M 111T(S) 112F 113S 127Q(T) 150F(Y) 151N(T) 295D (identity: 50.0 %/51.2 %)
13 m M 1 (B) non-polymer(FMT) FORMIC ACID 62S(T) 63N 64H (identity: 66.7 %/51.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4yo9_B_1 identity=51.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yo9_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGS  SS  SS  HHHHHHHS GGG EEEB SSS B   EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeebeeeebeeebeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :aa aaaa aaa  ag                                              mmm        g                           
Contact         :     ef   g  g                                                                                      
Contact         :     l                                                                                              

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yo9_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEEETTEEEEEEEEEEE SSS EEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeee:    
Contact         :       k     lll        aaaaal   i     aaaaa        lla             a  aa a     k                  i

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yo9_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHH-HHS  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebbbebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :ii              a                                                                      aa         l 

queryA       297:VRQ: 299
                :  *:
4yo9_B_1     297:NMQ: 299
SecStr          :HHH:    
ExpBur          :beb:    
Contact         :jea                                                                                                 
Contact         : fe                                                                                                 
Contact         : j                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123