#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yoi assembly_id=1

Protein Model on 4yoi assembly_id=1 (TEMPLATE: 4yoi assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 123S(T) 124G 125V 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 215G 283G 285A(S) 286L(T) 299Q 301S(M) (identity: 73.3 %/51.0 %)
3 c C 1 (A) non-polymer(4F4) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}thiophene-2-carboxamide 24T(S) 25T(M) 41H 44C 46S(A) 49M(L) 54Y 140F 141L 142N(C) 145C 163H 164H(Q) 165M 166E 187D 188R(K) 189Q (identity: 61.1 %/51.0 %)
4 d D 1 (A) non-polymer(ACT) ACETATE ION 62S(T) 63N 64H (identity: 66.7 %/51.0 %)
5 e E 1 (A) non-polymer(ACT) ACETATE ION 198T(K) 199T(Y) (identity: 0.0 %/51.0 %)
6 f F 1 (A) non-polymer(FMT) FORMIC ACID 133N 135T 137K 171V(T) 194A(Q) 197D (identity: 66.7 %/51.0 %)
7 g G 1 (A) non-polymer(FMT) FORMIC ACID 248D 249I(M) 255A(H) (identity: 33.3 %/51.0 %)
8 h H 1 (A) non-polymer(FMT) FORMIC ACID 277N(Q) 278G (identity: 50.0 %/51.0 %)
9 i I 1 (B) non-polymer(4F4) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}thiophene-2-carboxamide
10 j J 1 (B) non-polymer(FMT) FORMIC ACID
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yoi_A_1 identity=51.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yoi_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGGSSS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b         cc               c  c c  c    c       ddd                                    

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yoi_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BSSS  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeebbbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                         bbbb      f f bbbbbc  c                 cccb  bbfb              ccc    f  f
Contact         :                                       f  cc                        c                               

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yoi_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbbeebeebeeeeebeeeebbeebeeeebbebeeeeebee---bbeebebebeebbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :ee              bb                                 gg     g                     hh    b bb          

queryA       297:VRQCSGVTFQ: 306
                :  *  **  *:
4yoi_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHH       :    
ExpBur          :eebbeeeeee:    
Contact         :  b b                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123