#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4zuh assembly_id=1

Protein Model on 4zuh assembly_id=1 (TEMPLATE: 4zuh assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [298 aa] PEDV 3C-Like protease :K4L9I6_9ALPC
2 b B 1 (B) polymer(polypeptide(L)) [294 aa] PEDV 3C-Like protease :K4L9I6_9ALPC 1S(A) 2G 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 122P(A) 123S(A) 124G 125V 126Y 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 172H 278G 280T(Q) 283G 284S(Y) 285A(T) 286L(S) 299Q 300C(M) 301S(Y) 302G (identity: 60.0 %/45.1 %)
3 c C 1 (C) polymer(polypeptide(L)) [8 aa] peptide substrate SAVLQSGF 24T(N) 25T(M) 26T(A) 27L 41H 47E(T) 140F 141L(I) 142N 143G 144S(A) 145C(A) 163H 164H(Q) 165M(L) 166E 172H 187D 188R(Q) 189Q(P) 190T 191A(L) 192Q (identity: 47.8 %/45.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4zuh_A_1 identity=45.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
4zuh_A_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS   HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebebeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeebebeebbeebee--eebebbeeeeebebeebeeeebbbebebeeebeeeb:    
Contact         :bb bbbbbbbb  b         cccc             c     c                                                     

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** *   ***   ** * ** *** **  ** * **    * *** *  **  * * * ** *  **   *  * *  *    :
4zuh_A_1      99:KYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          :SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeeeee:    
Contact         :                      bbbbbbb        bbbbbcccc                 cccb     b              cccccc       
Contact         :                                        cc                        c     c                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
4zuh_A_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    --  GGGHHHHHHHS  HHHHHHHHHHHHH - TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbeebeeeebeebe--eeeebeebeeeeebebeebbbbbeebeee-beeeebeeeeebbbbbbbebbeee:    
Contact         :                                                                              b b  bbbb            b

queryA       300:CSG: 302
                :  *:
4zuh_A_1     296:MYG: 298
SecStr          :HH :    
ExpBur          :bee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123