#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5eu8 assembly_id=1

Protein Model on 5eu8 assembly_id=1 (TEMPLATE: 5eu8 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [300 aa] main protease :V9PIT1_9ALPC 4R 5K 6M 7A 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 139S 141L(I) 169T(N) 170G 278G 284S(Y) 298R 299Q 302G (identity: 77.3 %/44.8 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [300 aa] main protease :V9PIT1_9ALPC
3 c B 1 (B) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
4 d B 2 (B) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 25T(N) 26T(V) 27L 41H 47E(T) 54Y 140F 145C 163H 164H 165M(L) 166E 168P(G) 188R(Q) 189Q(P) 190T(S) 191A(M) (identity: 47.1 %/44.8 %)
5 e C 1 (A) non-polymer(ZN) ZINC ION
6 f C 2 (A) non-polymer(ZN) ZINC ION 41H 164H 187D (identity: 100.0 %/44.8 %)
7 g D 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
8 h D 2 (A) non-polymer(EDO) 1,2-ETHANEDIOL 180N(E) (identity: 0.0 %/44.8 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5eu8_A_2 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***  *     ***     *  * *         * ***   ** ** :
5eu8_A_2       6:SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPE: 104
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGS S SSS -  HHHHHHT  GGGEEEEETTEEE EEE  EETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeeebbbbbbbeeebbbbbbbbbeeeeee-bebeebeeeeeeeebebebeeeebebeeeebeebbbbbebeeebeeebe:    
Contact         :   aaaa aaa  a          ddd             d     d      d                                              
Contact         :                                        f                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **    **  *  **** * *  **   **   ******  * *****         * **** **  * * *  ***  **   *    *  **    :
5eu8_A_2     105:HKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMS: 204
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE SSS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbeebbbeeebeebbebbbbbbeeeeebbbbbbbbeebeeebbbbbbbebebbeebebbeeeeebeeeeeb:    
Contact         :                     aaaaa            ada   d                 dddd daa         h      fdddd         
Contact         :                                                               f                                    

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***      **   *  *             *    * * **  *          *  *  *****    * *****  * ** :
5eu8_A_2     205:SDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 301
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeebeebebeeebebeebbebbeeeebeebee--eeebeebbeebeeebeebbbbbbe-beeebeeeebbeeeebbbbbbbebbeeeb:    
Contact         :                                                                             a     a             aa 

queryA       301:SGV: 303
                : **:
5eu8_A_2     302:YGV: 304
SecStr          :T  :    
ExpBur          :eee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123