#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5hyo assembly_id=1

Protein Model on 5hyo assembly_id=1 (TEMPLATE: 5hyo assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC
2 b B 1 (B) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC 1S(A) 2G 3F(L) 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P(A) 123S(A) 124G 125V 126Y 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 170G 172H 274N 277N(G) 278G 279R(K) 283G 284S(Y) 285A(T) 290E 299Q 300C(M) 302G (identity: 62.2 %/45.7 %)
3 c C 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 302G (identity: 100.0 %/45.7 %)
4 d D 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 19Q(R) 119N(D) (identity: 0.0 %/45.7 %)
5 e E 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL
6 f F 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 131R 137K(R) 169T(S) 171V(C) 194A(E) (identity: 20.0 %/45.7 %)
7 g G 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 35V(T) 37Y(I) 88K(Q) 101Y 103F(Y) (identity: 20.0 %/45.7 %)
8 h H 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 6M 8F(Q) 111T(S) 112F 113S(N) 151N 295D(E) 298R 299Q (identity: 55.6 %/45.7 %)
9 i I 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L(I) 144S(A) 145C 163H 165M(L) 166E (identity: 57.1 %/45.7 %)
10 j J 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL
11 k K 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL
12 l L 1 (B) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 1S(A) (identity: 0.0 %/45.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5hyo_A_1 identity=45.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
5hyo_A_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGSS SSSS   HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebebeeeebeebeebbbebbbeebebbbbbbbebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebebeeeeeeebbbebebeeebeeeb:    
Contact         :bbbb bbbbbb  b    d               g g                                                   g           
Contact         :l    h h                                                                                            

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** **  ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5hyo_A_1      99:KYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          : EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeeeee:    
Contact         : g g       hhh     d  bbbbbbb  f     bbbbb  ii     h           i ib  fbfb                     f     
Contact         :                                     f  ii                        i                                 

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5hyo_A_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    --  GGGHHHHHHH   HHHHHHHHHHHHS -  SS BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebbbeeebebeebbebbeeeebbebe--eeeebeebeeeeebebeebbbbbbebeee-eeeeebbeeebbbbbbbbebbbee:    
Contact         :                                                                          b  bbb   bbb    b    h  hb
Contact         :                                                                                                   h

queryA       300:CSGVTF: 305
                :  **  :
5hyo_A_1     296:MYGVNL: 301
SecStr          :HHS   :    
ExpBur          :beeeee:    
Contact         :b b                                                                                                 
Contact         :  c                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123