#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nh0 assembly_id=1

Protein Model on 5nh0 assembly_id=1 (TEMPLATE: 5nh0 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 1S 2G 4R(K) 5K 6M 7A 9P 10S 11G 14E 15G(R) 122P(A) 123S 124G 125V 126Y(F) 127Q(G) 137K 138G 139S 140F 141L(I) 166E 170G 172H 285A 286L(S) 290E 298R(K) 299Q 301S(Y) (identity: 71.0 %/45.3 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL
3 c B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL 19Q(R) 64H 69Q(S) 71G(N) 72N(G) 74Q(F) 76R(G) 119N(E) 121S(I) (identity: 11.1 %/45.3 %)
4 d B 2 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL 154Y(N) 248D(E) 251G(S) 252P(I) 297V 298R(K) (identity: 16.7 %/45.3 %)
5 e C 1 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL
6 f C 2 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 33D(G) 34D 92D(S) 94A(S) 95N 96P(V) 98T 100K (identity: 50.0 %/45.3 %)
7 g D 1 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
8 h D 2 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate 26T(V) 41H 47E(T) 140F 142N 143G 144S(A) 145C 163H 164H(Q) 165M(I) 166E 172H 187D 188R(Q) 189Q(P) (identity: 56.2 %/45.3 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 202V(D) 249I(C) 250L(Y) 293P(L) (identity: 0.0 %/45.3 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 131R 137K (identity: 100.0 %/45.3 %)
13 m G 1 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
14 n G 2 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
15 o H 1 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
16 p H 2 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
17 q I 1 (C) non-polymer(GOL) GLYCEROL
18 r I 2 (C) non-polymer(GOL) GLYCEROL
19 s J 1 (C) non-polymer(GOL) GLYCEROL
20 t J 2 (C) non-polymer(GOL) GLYCEROL
21 u K 1 (C) non-polymer(DMS) DIMETHYL SULFOXIDE
22 v K 2 (C) non-polymer(DMS) DIMETHYL SULFOXIDE
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5nh0_A_2 identity=45.3%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
5nh0_A_2       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebebeebebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeebeeebeeeebebbeeeeebbeeebebeebbbebebeeebeeebe:    
Contact         :aa aaaa aaa  aa   c      h      ff      h     h                c    c cc c c               f fff f f

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
5nh0_A_2     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSS         B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :                  c caaaaaa   l     aaaaahhhh        d         hhha   a a              hhh          
Contact         :                                    l  h                          h     h                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  *** * * ****   ** *:
5nh0_A_2     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYASLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB     --GGGGHHHHHHH   HHHHHHHHHH-HHT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebeeeebbebbeeeebbebee--eeebeebeeebebebebbbbbbee-beeebeeeebeeeeebbbebbeebbeee:    
Contact         :  j                                             djjdd                                aa   a  j   daa
Contact         :                                                                                                  d 

queryA       300:CSG: 302
                :  *:
5nh0_A_2     297:MYG: 299
SecStr          :HT :    
ExpBur          :bee:    
Contact         : a                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123