#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nh0 assembly_id=1

Protein Model on 5nh0 assembly_id=1 (TEMPLATE: 5nh0 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 50L 53N(D) 56D(H) 168P(G) 190T(S) 191A(L) (identity: 16.7 %/45.2 %)
2 b A 2 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 169T(S) 193A(V) 195G(S) 196T(A) 197D(N) 198T(L) 235M 236K(A) 237Y(N) 238N(G) (identity: 10.0 %/45.2 %)
3 c A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL
4 d B 2 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL
5 e C 1 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 1S 2G 4R(K) 5K 6M 7A 9P 10S 11G 14E 15G(R) 122P(A) 123S 124G 125V 126Y(F) 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 285A(S) 286L(S) 290E 298R(K) 299Q 300C(M) 301S(Y) 302G (identity: 65.6 %/45.2 %)
6 f C 2 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 274N(E) (identity: 0.0 %/45.2 %)
7 g D 1 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
8 h D 2 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m G 1 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate 26T(V) 41H 47E(T) 140F 141L(I) 142N 143G 144S(A) 145C 163H 164H(Q) 165M(I) 166E 187D 188R(Q) 189Q(P) (identity: 50.0 %/45.2 %)
14 n G 2 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
15 o H 1 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
16 p H 2 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
17 q I 1 (C) non-polymer(GOL) GLYCEROL 118Y 123S (identity: 100.0 %/45.2 %)
18 r I 2 (C) non-polymer(GOL) GLYCEROL
19 s J 1 (C) non-polymer(GOL) GLYCEROL
20 t J 2 (C) non-polymer(GOL) GLYCEROL
21 u K 1 (C) non-polymer(DMS) DIMETHYL SULFOXIDE
22 v K 2 (C) non-polymer(DMS) DIMETHYL SULFOXIDE
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:5nh0_B_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
5nh0_B_1       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebebeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebeeeebbbebebeeebeeebe:    
Contact         :ee eeee eee  ee          m              m     m  a  a  a                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
5nh0_B_1     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :                 q   eeeeee         eeeeemmmm                  mmme ab  e              mmmaa b bbbb 
Contact         :                      q                mm                         m                                 

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
5nh0_B_1     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB     --GGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebbbeeebebeebbebbeeeebbebee--eeebeebeeebebebebbbbbbee-beeebeeeebeeeeebbbebbeebbeee:    
Contact         :                                   bbbb                                   f          ee   e       ee

queryA       300:CSGV: 303
                :  **:
5nh0_B_1     297:MYGV: 300
SecStr          :HH  :    
ExpBur          :beee:    
Contact         :eee                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123