#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nh0 assembly_id=1

Protein Model on 5nh0 assembly_id=1 (TEMPLATE: 5nh0 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description f(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL
2 b A 2 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 213I(L) 217R 220L 224T(R) 257T 258G 259I(V) (identity: 57.1 %/45.0 %)
3 c B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL 223F(T) (identity: 0.0 %/45.0 %)
4 d B 2 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL 1S 2G 4R(K) 5K 6M 7A 9P 10S 11G 14E 15G(R) 122P(A) 123S 124G 125V 126Y(F) 127Q(G) 128C(V) 137K 138G 139S 140F 141L(I) 166E 170G 172H 285A(S) 286L(S) 290E 299Q 300C(M) 301S(Y) 302G (identity: 66.7 %/45.0 %)
5 e C 1 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 221N(C) 222R(S) 223F(T) 270E(H) 274N(E) 275G 277N(G) 278G (identity: 25.0 %/45.0 %)
6 f A(queryA) C 2 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL
7 g D 1 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
8 h D 2 (A) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m G 1 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
14 n G 2 (B) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
15 o H 1 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate
16 p H 2 (C) non-polymer(8X8) ~{tert}-butyl ~{N}-[(2~{S},3~{R})-3-oxidanyl-4-oxidanylidene-1-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]carbamate 26T(V) 41H 47E(T) 140F 141L(I) 142N 143G 144S(A) 145C 163H 164H(Q) 166E 172H 187D 188R(Q) 189Q(P) (identity: 56.2 %/45.0 %)
17 q I 1 (C) non-polymer(GOL) GLYCEROL
18 r I 2 (C) non-polymer(GOL) GLYCEROL 6M 298R(K) 299Q (identity: 66.7 %/45.0 %)
19 s J 1 (C) non-polymer(GOL) GLYCEROL
20 t J 2 (C) non-polymer(GOL) GLYCEROL 5K 6M 8F(Q) 111T(S) 112F 113S(N) 127Q(G) 151N 295D(E) 298R(K) (identity: 40.0 %/45.0 %)
21 u K 1 (C) non-polymer(DMS) DIMETHYL SULFOXIDE
22 v K 2 (C) non-polymer(DMS) DIMETHYL SULFOXIDE 131R (identity: 100.0 %/45.0 %)
ALIGNMENTS
MODEL[6] Protein A "queryA" TEMPLATE:5nh0_C_2 identity=45.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
5nh0_C_2       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebeeeebbbebebeeebeeebe:    
Contact         :dd ddddtddd  dd          p              p     p                                                     
Contact         :    tr                                                                                              
Contact         :     t                                                                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
5nh0_C_2     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSS         B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :          ttt        ddddddd  v     dddddpppp     t            pp d   d d              ppp          
Contact         :                          t            pp                         p     p                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
5nh0_C_2     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB     --GGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS   S  HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebeeeebbebbeeeebbebee--eeebeebeeebebebebbbbbbee-beeebeeeebeeeeebbbebbeebbeee:    
Contact         :             b   b  beecb                                bbb          e   ee ee      dd   d    t  rd
Contact         :                       e                                                                          tr

queryA       300:CSG: 302
                :  *:
5nh0_C_2     297:MYG: 299
SecStr          :HH :    
ExpBur          :bee:    
Contact         :ddd                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123