#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5rgy assembly_id=1

Protein Model on 5rgy assembly_id=1 (TEMPLATE: 5rgy assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 299Q 301S 302G 303V 304T (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(UGS) N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)acetamide
4 d B 2 (A) non-polymer(UGS) N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)acetamide 49M 164H 165M 166E 167L 168P 189Q 190T 191A (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 75L 76R (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 7A 8F 127Q 295D 298R (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 14E 15G 17M 18V 70A (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1S (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 140F 141L 142N 144S 163H 165M 166E (identity: 100.0 %/100.0 %)
13 m G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
14 n G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 196T 198T 240E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5rgy_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
5rgy_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  aj jj                              d                    j   fff                        
Contact         :k    hhh     j                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
5rgy_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebbb:    
Contact         :                 a  aaaaaaa         aaaaal l                  lddadd   a                ddd    n n  
Contact         :                      g   h            ll                       ld                                  
Contact         :                                                                 l                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
5rgy_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebeeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                       n                                       a  a aa   a    h  ha 

queryA       301:SGVT: 304
                :****:
5rgy_A_2     301:SGVT: 304
SecStr          :TT  :    
ExpBur          :eeee:    
Contact         :aaaa                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123