#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5rh0 assembly_id=1

Protein Model on 5rh0 assembly_id=1 (TEMPLATE: 5rh0 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 170G 172H 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(UH4) N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea
4 d B 2 (A) non-polymer(UH4) N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea 49M 140F 141L 142N 144S 145C 163H 165M 166E 188R 189Q (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 74Q 75L 76R (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 8F 127Q 298R (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 14E 15G 17M 70A 97K (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 132P 133N 196T 198T 240E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5rh0_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
5rh0_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeeebeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  aj j                               d                    j   fff                    j   
Contact         :     h h     j                                                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
5rh0_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                 a  aaaaaaa    ll   aaaaad dd                 d da   a a               dd      l l  
Contact         :                      g   h            dd                        d                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
5rh0_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebeeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeee:    
Contact         :                                       l                                          a aa   a       haa

queryA       301:SGVT: 304
                :****:
5rh0_A_2     301:SGVT: 304
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :aaaa                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123