#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkj assembly_id=1

Protein Model on 5wkj assembly_id=1 (TEMPLATE: 5wkj assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 141L 169T(N) 170G 171V(T) 283G 284S 285A(T) 286L(M) 298R(M) 299Q 302G (identity: 62.1 %/52.2 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC
3 c B 1 (A) non-polymer(CA) CALCIUM ION
4 d B 2 (A) non-polymer(CA) CALCIUM ION
5 e C 1 (A) non-polymer(CA) CALCIUM ION
6 f C 2 (A) non-polymer(CA) CALCIUM ION 98T (identity: 100.0 %/52.2 %)
7 g D 1 (A) non-polymer(B1S) (1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
8 h D 2 (A) non-polymer(B1S) (1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 49M(L) 140F 141L 142N(C) 144S 145C 163H 164H(Q) 165M 166E 172H 187D 188R(K) 189Q (identity: 73.3 %/52.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5wkj_A_2 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
5wkj_A_2       8:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANPS: 107
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTS SS  HHHHHHH  GGGEEEE   --- EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :bebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbebbbeeeeeeebebeebeeebeeeebebeeee---eebebebeeeeebbbebebeeebee:    
Contact         : a aaaaaaaa  a                          h       h                                                   

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
5wkj_A_2     108:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 207
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbbebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeee:    
Contact         :f                       aaaaa          aaahah hh                 hhhh  aaah              hhh        
Contact         :                                           h                                                        

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
5wkj_A_2     208:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 303
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   SS HHHH:    
ExpBur          :eebbebbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :                                                                                      aaaa          

queryA       297:VRQCSGV: 303
                :  *  **:
5wkj_A_2     304:NMQIMGV: 310
SecStr          :HHHHH  :    
ExpBur          :beeeeee:    
Contact         : aa  a                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123