#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkk assembly_id=1

Protein Model on 5wkk assembly_id=1 (TEMPLATE: 5wkk assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC 2G 4R(V) 5K 6M 7A(S) 8F(H) 9P 10S 11G 14E 122P 123S(T) 124G 125V(T) 126Y(F) 137K 138G 139S 141L 168P(A) 169T(N) 170G 171V(T) 280T(Q) 283G 285A(T) 286L(M) 298R(M) 299Q 300C(I) 302G (identity: 54.8 %/52.2 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC
3 c B 1 (A) non-polymer(PG4) TETRAETHYLENE GLYCOL 118Y 123S(T) (identity: 50.0 %/52.2 %)
4 d B 2 (A) non-polymer(PG4) TETRAETHYLENE GLYCOL 6M 7A(S) 8F(H) 298R(M) (identity: 25.0 %/52.2 %)
5 e C 1 (A) non-polymer(MG) MAGNESIUM ION
6 f C 2 (A) non-polymer(MG) MAGNESIUM ION
7 g D 1 (A) non-polymer(AW4) (1S,2S)-2-[(N-{[2-(3-chlorophenyl)ethoxy]carbonyl}-L-leucyl)amino]-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
8 h D 2 (A) non-polymer(AW4) (1S,2S)-2-[(N-{[2-(3-chlorophenyl)ethoxy]carbonyl}-L-leucyl)amino]-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 49M(L) 140F 141L 142N(C) 143G 144S 145C 163H 164H(Q) 165M 166E 168P(A) 172H 187D 189Q 190T(V) 191A(H) (identity: 66.7 %/52.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5wkk_A_2 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
5wkk_A_2       8:SGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPS: 107
SecStr          : S        HHHHTTEEEEEE - EEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEE  ---- EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :bebeeeeeebeebeebbbbbbbe-eebbbbbbeeebbbbbbbbbeeebeeebebeebbeebeeeebebebe----eebebeeeeeeebbbbbebeeebee:    
Contact         : a aaaaaaaa  a                          h       h                                                   
Contact         :     ddd                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
5wkk_A_2     108:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 207
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeee:    
Contact         :                    c   aaaaa          aaahahhhh                 hhhh aaaah              h hhh      
Contact         :                         c                 h                          h                             

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
5wkk_A_2     208:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 303
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-T  TT  BTTBSS   SS HHHH:    
ExpBur          :bebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbebbbebe-eebeeeebeeeeebebebbbebb:    
Contact         :                                                                                   a  a aa          

queryA       297:VRQCSGV: 303
                :  *  **:
5wkk_A_2     304:NMQIMGV: 310
SecStr          :HHHTT  :    
ExpBur          :beeeeee:    
Contact         : aaa a                                                                                              
Contact         : d                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123