#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5zqg assembly_id=1

Protein Model on 5zqg assembly_id=1 (TEMPLATE: 5zqg assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [292 aa] Non-structural protein :R4JK63_9ALPC
2 b B 1 (B) polymer(polypeptide(L)) [294 aa] Non-structural protein :R4JK63_9ALPC 1S(A) 2G 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P(A) 123S(A) 124G 125V 126Y 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 172H 278G 280T(Q) 283G 284S(Y) 285A(T) 286L(S) 299Q 300C(M) 301S(Y) 302G (identity: 58.8 %/44.8 %)
3 c C 1 (C) polymer(polypeptide(L)) [7 aa] PEPTIDE LEU-ALA-GLN-LEU-GLN-VAL-ALA 24T(N) 25T(M) 26T(A) 27L 41H 140F 141L(I) 143G 144S(A) 145C(A) 163H 164H(Q) 165M(L) 166E 172H 187D 188R(Q) 189Q(P) 190T 191A(L) 192Q (identity: 47.6 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5zqg_A_1 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDM-LNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******           *     *   ***    *** * * *  *    *  **   *  **:
5zqg_A_1       2:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIAXXXXXXIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG ------  HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebebeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbe------eebeebeeebee--eebebbeeeeebeeeebebeebbbebebeeebeeeb:    
Contact         :bb b bbbbbb  b         cccc             c                                                           

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** *   ***   ** * ** *** **  ** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5zqg_A_1     100:KYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 199
SecStr          :SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeee:    
Contact         :                      bbbbbbb        bbbbb ccc                 cccb     b              cccccc       
Contact         :                                        cc                        c     c                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5zqg_A_1     200:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    --  GGGHHHHHHHS  HHHHHHHHHHHHH - TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbeebeeeebeebe--eeeebeebeeeeebebeebbbbbeebeee-beeeebeeeeebbbbbbbebbeee:    
Contact         :                                                                              b b  bbbb            b

queryA       300:CSG: 302
                :  *:
5zqg_A_1     297:MYG: 299
SecStr          :HH :    
ExpBur          :bee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123