#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6m0k assembly_id=1

Protein Model on 6m0k assembly_id=1 (TEMPLATE: 6m0k assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b B 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 15G 17M 18V 31W 70A 71G 97K (identity: 100.0 %/100.0 %)
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 165M 166E 168P 188R 189Q 190T 192Q (identity: 100.0 %/100.0 %)
4 d D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 118Y 141L (identity: 100.0 %/100.0 %)
5 e E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 6M 7A 8F 127Q 298R (identity: 100.0 %/100.0 %)
6 f F 1 (A) non-polymer(FJC) ~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]propan-2-yl]-1~{H}-indole-2-carboxamide 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 186V 187D 188R 189Q (identity: 100.0 %/100.0 %)
7 g A 2 (A) polymer(polypeptide(L)) [304 aa] Replicase polyprotein 1ab :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 280T 283G 285A 286L 290E 298R 299Q 301S 303V (identity: 100.0 %/100.0 %)
8 h B 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
9 i C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 298R (identity: 100.0 %/100.0 %)
11 k E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 123S (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(FJC) ~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]propan-2-yl]-1~{H}-indole-2-carboxamide
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6m0k_A_1 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6m0k_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :gg ggeeeggg  gb bb            b         f       f                    bb                         b   
Contact         :     ggg                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6m0k_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                 d   ggggge         gggfdffff                 ffcc c   f             ffccc c        
Contact         :                      k   g            gf                       ff     g               ff           
Contact         :                                        g                        g                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6m0k_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbbeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                                                               g  g gg   g       eg 
Contact         :                                                                                                 g  
Contact         :                                                                                                 j  

queryA       301:SGVT: 304
                :****:
6m0k_A_1     301:SGVT: 304
SecStr          :TTT :    
ExpBur          :eeee:    
Contact         :g g                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123