#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w79 assembly_id=1

Protein Model on 6w79 assembly_id=1 (TEMPLATE: 6w79 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] Main protease 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 285A(T) 286L(I) 298R 299Q 300C 301S (identity: 93.8 %/96.1 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] Main protease
3 c B 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
4 d B 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 84N (identity: 100.0 %/96.1 %)
5 e C 1 (A) non-polymer(X77) N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)-2-oxo-1-(pyridin-3-yl)ethyl]-1H-imidazole-4-carboxamide
6 f C 2 (A) non-polymer(X77) N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)-2-oxo-1-(pyridin-3-yl)ethyl]-1H-imidazole-4-carboxamide 25T 26T 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 187D 188R 189Q (identity: 100.0 %/96.1 %)
7 g D 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
8 h D 2 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 105R 134F(H) 181F 182Y 183G (identity: 80.0 %/96.1 %)
9 i E 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
10 j E 2 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 53N 56D 60R (identity: 100.0 %/96.1 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6w79_A_2 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
6w79_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TT SSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebebeeeebebebeeebebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a          ff              f       f   j  j   j                       d                

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
6w79_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeeb:    
Contact         :    h                aaaaaaa     h  aaaaaffff                 fffa   a a        hhh   fff           
Contact         :                                       ff                        f                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
6w79_A_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebebbbebbeeeb:    
Contact         :                                                                                    aa           aaa

queryA       301:SGVTFQ: 306
                :******:
6w79_A_2     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    
Contact         :a                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123