#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wtt assembly_id=1

Protein Model on 6wtt assembly_id=1 (TEMPLATE: 6wtt assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 280T 283G 285A 286L 290E 298R 299Q 301S 302G (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_SARS2
3 c D 1 (A) non-polymer(K36) (1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
4 d D 2 (A) non-polymer(K36) (1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 187D 189Q 190T 191A 192Q (identity: 100.0 %/100.0 %)
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
6 f E 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 227L 243T 244Q 245D (identity: 100.0 %/100.0 %)
7 g F 1 (A) non-polymer(GOL) GLYCEROL
8 h F 2 (A) non-polymer(GOL) GLYCEROL 223F 269K 270E 273Q (identity: 100.0 %/100.0 %)
9 i G 1 (A) non-polymer(CL) CHLORIDE ION 122P (identity: 100.0 %/100.0 %)
10 j G 2 (A) non-polymer(CL) CHLORIDE ION
11 k H 1 (A) non-polymer(CL) CHLORIDE ION 5K (identity: 100.0 %/100.0 %)
12 l H 2 (A) non-polymer(CL) CHLORIDE ION 5K 126Y 127Q (identity: 100.0 %/100.0 %)
13 m I 1 (A) non-polymer(CL) CHLORIDE ION
14 n I 2 (A) non-polymer(CL) CHLORIDE ION 103F (identity: 100.0 %/100.0 %)
15 o J 1 (A) non-polymer(MG) MAGNESIUM ION
16 p J 2 (A) non-polymer(MG) MAGNESIUM ION 58L 82M (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6wtt_A_2 identity=100.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6wtt_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGGEEEESSS EE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeebeeeebebeeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aa aaaaaaaa  a                          d       d        p                       p                  
Contact         :    k                                                                                               
Contact         :    l                                                                                               

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :****************************************************************************************************:
6wtt_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :  n                  aaaaaaa        aaaaadddd                 ddda d a a              d dddd        
Contact         :                     i   ll            dd                        d     d                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6wtt_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT       HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbeebbeeebeeeebeebeebebbbbbebbeebb:    
Contact         :                      h   f               fff                       hh  h      a  a aa   a       aa 

queryA       301:SG: 302
                :**:
6wtt_A_2     301:SG: 302
SecStr          :T :    
ExpBur          :ee:    
Contact         :aa                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123