#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xb1 assembly_id=1

Protein Model on 6xb1 assembly_id=1 (TEMPLATE: 6xb1 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 140F 141L 166E 170G 172H 280T 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/99.7 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(NEN) 1-ETHYL-PYRROLIDINE-2,5-DIONE
4 d B 2 (A) non-polymer(NEN) 1-ETHYL-PYRROLIDINE-2,5-DIONE 100K 101Y 102K 156C (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6xb1_A_2 identity=99.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :****************************************************************************************************:
6xb1_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  a                                                                                     d

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :******************************************** *******************************************************:
6xb1_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSUGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeebbebbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :dd               a  aaaaaaaa        aaaaa              d         a   a a                            

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :****************************************************************************************************:
6xb1_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebeeeeebebeebbbbbeebbeeebeeeebeeeeebbbbbbbebbebbe:    
Contact         :                                                                               a  a aa   a        aa

queryA       301:SGVTFQ: 306
                :******:
6xb1_A_2     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :aaaaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123