#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xbg assembly_id=1

Protein Model on 6xbg assembly_id=1 (TEMPLATE: 6xbg assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [300 aa] main protease :R1AB_SARS2 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 286L 290E 298R 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [303 aa] main protease :R1AB_SARS2
3 c C 1 (C) polymer(polypeptide(L)) [4 aa] inhibitor UAW246
4 d D 1 (E) polymer(polypeptide(L)) [4 aa] inhibitor UAW246 26T 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 187D 189Q (identity: 100.0 %/100.0 %)
5 e E 1 (B) non-polymer(GOL) GLYCEROL 62S 63N 64H (identity: 100.0 %/100.0 %)
6 f F 1 (B) non-polymer(GOL) GLYCEROL 14E 15G 16C 17M 18V 31W 70A 97K (identity: 100.0 %/100.0 %)
7 g G 1 (B) non-polymer(GOL) GLYCEROL 3F 4R 5K (identity: 100.0 %/100.0 %)
8 h H 1 (B) non-polymer(NA) SODIUM ION 271L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6xbg_B_1 identity=100.0%
queryA         3:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 102
                :****************************************************************************************************:
6xbg_B_1       5:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 104
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGG SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  EEE:    
ExpBur          :eeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebeeeeeeebbbebebeeebeeebeee:    
Contact         :gaaaaaaaa  affff       d    f         d       d            eee     f                          f     
Contact         : gg        f                                                                                        

queryA       103:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 202
                :****************************************************************************************************:
6xbg_B_1     105:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 204
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebbb:    
Contact         :                   aaaaaaa        aaadadddd                 dddd     d              d d             
Contact         :                                      d                                                             

queryA       203:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG: 302
                :****************************************************************************************************:
6xbg_B_1     205:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG: 304
SecStr          :HHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHHS :    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeebeeebeebbbbbeebbeeebeeeebeeeeeeebbbbbebbebeeee:    
Contact         :                                                                    h              a   a       aaaaa

queryA       303:VTF: 305
                :***:
6xbg_B_1     305:VTF: 307
SecStr          :   :    
ExpBur          :eee:    
Contact         :aaa                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123