#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xbh assembly_id=1

Protein Model on 6xbh assembly_id=1 (TEMPLATE: 6xbh assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] main protease :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [304 aa] main protease :R1AB_SARS2 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 283G 285A 286L 290E 299Q 300C 302G 303V 304T 305F (identity: 100.0 %/100.0 %)
3 c B 1 (C) polymer(polypeptide(L)) [3 aa] inhibitor UAW247 41H 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 187D 188R 189Q (identity: 100.0 %/100.0 %)
4 d B 2 (C) polymer(polypeptide(L)) [3 aa] inhibitor UAW247
5 e C 1 (A) non-polymer(GOL) GLYCEROL 62S 63N 64H (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(GOL) GLYCEROL
7 g D 1 (A) non-polymer(NA) SODIUM ION 63N 76R 77V (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(NA) SODIUM ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xbh_A_1 identity=100.0%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :****************************************************************************************************:
6xbh_A_1       4:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 103
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGG SS  HHHHHHH  GGG EEEETTEE  EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeeebeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebee:    
Contact         :b bbbbbbbb  b                          c       c    c       eee           gg                        
Contact         :                                                             g                                      

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                :****************************************************************************************************:
6xbh_A_1     104:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 203
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B H:    
ExpBur          :eeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeebb:    
Contact         :                b  bbbbbbbb        bbbcbcccc                 cccc     c              ccc            
Contact         :                                       c                                                            

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :****************************************************************************************************:
6xbh_A_1     204:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 303
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHHH:    
ExpBur          :bbbbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbeebbeeebeeeebbebeebebbbbbebbeeeee:    
Contact         :                                                                                 b bb   b        bb 

queryA       302:GVTF: 305
                :****:
6xbh_A_1     304:GVTF: 307
SecStr          :T   :    
ExpBur          :eeee:    
Contact         :bbbb                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123